SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10228.JGI59127 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10228.JGI59127
Domain Number 1 Region: 214-241
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000173
Family Retrovirus zinc finger-like domains 0.0047
Further Details:      
 
Weak hits

Sequence:  10228.JGI59127
Domain Number - Region: 285-328
Classification Level Classification E-value
Superfamily RING/U-box 0.000127
Family Zf-UBP 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI59127
Sequence length 432
Comment (Trichoplax adhaerens)
Sequence
MALHKQKAYMYAKEFNLRSIRDNLQAYNLVTRQFDQRDIESNVNIHRLDKGKVYGSLITM
QRHPLMDTKESTPTVKRKQRRRKRRKKNSGTKTVTNSDNTGMKPVGSTESHVKNHKEHLK
LPDIFRSGTTAIEMESENFAKVTPNDDTEIRSSYFGLVSYSSSSNEASDACESCNNFSND
RIASVCRPKSEIRTSGKTETSSETEEYDFTNNNWRKSHSNLSSFKCWKCKRIGHLANDCT
VTPNIDRSLPLASNNNSYQRGINTFNKRHASSKLIHLYRKCRKIRKLKDPSCIRCGTDTN
VALCLDCDTMFCDGNGHLVDHLLEHPDHNKLFSFKLRRLIKCCKPTCDIIDIYKLRKCSI
CLDKFSSRHYSMINALWSQTGIRNMPNAVCCEDHFEWHRMNCGTISEEMFADQKLLEKKK
SSGNGFVSEFFF
Download sequence
Identical sequences B3S4L3
jgi|Triad1|59127|fgeneshTA2_pg.C_scaffold_9000346 XP_002115033.1.101920 10228.JGI59127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]