SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10228.JGI61140 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10228.JGI61140
Domain Number 1 Region: 4-47
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000227
Family Retrovirus zinc finger-like domains 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI61140
Sequence length 281
Comment (Trichoplax adhaerens)
Sequence
MIQHRCRNCGATGHRYWECPEQRNLTSTIACTICGGIGHVATDCKQKSNEEGGNEPVEPV
IDREKMDNEYLSLMAELGEGSAPEEITKKPDTTSAATSTPATNLNTVITTATIATTTSTT
AVPAPPAPAPAPAPTSVPISGGPHPMPPASGMPMTNMPMAPGPPGFGAFPPYGYPMMPQP
TWGGYQPWGYPPMQQPLPHGPSVPSGNPPPPGLAASDTNPSAVPSAPWQQANVPNPGGAP
WLQPGAAAPGFDSKNVTAPPPPGTAPWQQAPPPPPPPPPEP
Download sequence
Identical sequences B3SA56
XP_002117155.1.101920 10228.JGI61140 jgi|Triad1|61140|fgeneshTA2_pg.C_scaffold_21000096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]