SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10228.JGI62922 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  10228.JGI62922
Domain Number - Region: 75-100
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00182
Family Retrovirus zinc finger-like domains 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI62922
Sequence length 101
Comment (Trichoplax adhaerens)
Sequence
MAMPCVHAVGAINSAGFAIEDYVGSYYLASTLRNTYQGEVLMISSVDIAEAHAEVVLPPV
VERRPGRPKKRRVRSSTEEDKRTLSCSQCSGTGHNKRTCNK
Download sequence
Identical sequences B3SFC2
10228.JGI62922 XP_002118941.1.101920 jgi|Triad1|62922|fgeneshTA2_pg.C_scaffold_2527000001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]