SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 10228.JGI63775 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  10228.JGI63775
Domain Number 1 Region: 110-162
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000000968
Family Retrovirus zinc finger-like domains 0.004
Further Details:      
 
Domain Number 2 Region: 57-105
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000163
Family Retrovirus zinc finger-like domains 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 10228.JGI63775
Sequence length 209
Comment (Trichoplax adhaerens)
Sequence
MTRFARSNQNKGRKLDKATPWKELKPQYAGNKNKSKRPDPGSKMKMHHIGKADQAKLQKK
KTVCFKCRQPGHKVSKCKAESGNSSEKICFKCGSSNHSLYQCTQYDQSRRDDPLPFAKCF
ICQGVGHLSKSCPDNPRGLYPLGGSCKLCGSVEHFHRDCPMRHKEEESELKLRVLNSTVS
ADDDGMVTISKSIKTNFSKAKGRPKIVRF
Download sequence
Identical sequences B3RSN3
10228.JGI63775 jgi|Triad1|63775|estExt_fgeneshTA2_pg.C_30666 XP_002110542.1.101920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]