SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 103690.all2283 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  103690.all2283
Domain Number 1 Region: 6-101
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.37e-20
Family Anti-sigma factor antagonist SpoIIaa 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 103690.all2283
Sequence length 109
Comment (Nostoc sp)
Sequence
MYSNVNTKIIQPSGFFDGKKGRQIHEEISKTITSDVTTILIDFQFVTFMDSSGFGTLLLT
LKTVRQKKARLALCSINEQIKMILELSDTSKVFEVFPDQAAFMQTVTQY
Download sequence
Identical sequences A0A1Z4KG03 Q8YUQ2
WP_010996440.1.33676 103690.all2283 gi|17229775|ref|NP_486323.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]