SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 103690.all2962 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  103690.all2962
Domain Number 1 Region: 2-68
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 5.63e-17
Family SinR domain-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 103690.all2962
Sequence length 102
Comment (Nostoc sp)
Sequence
MLNEALRLMRVFHDLSQKEMAERLGISKSYLSEIESGKKIPTLDLLNRYSGLFDIPVSSI
MFFSENLDKDVKTEKLRNFVSSKIIAILNFIAERSGNACAED
Download sequence
Identical sequences Q8YSW7
103690.all2962 WP_010997113.1.33676 gi|17230454|ref|NP_487002.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]