SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 103690.all4220 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  103690.all4220
Domain Number 1 Region: 39-138
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 7.98e-28
Family Pentapeptide repeats 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 103690.all4220
Sequence length 152
Comment (Nostoc sp)
Sequence
MKLKLFAALALATPLFLANSVTAGNPQDLQRLLSTGECNGCNLTGMNLSGEHLIGADLRG
ANLAGANLEGANLEGADLTNANLKKANLTSAYLTNVNFKKANLNGANLTRAHVIDSNVYG
ASMDNLTITDAEIYNTAIGIGGEEAQNIPDWD
Download sequence
Identical sequences A0A1Z4KLI6 Q8YPH4
WP_010998358.1.33676 gi|17231712|ref|NP_488260.1| 103690.all4220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]