SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 103690.alr3444 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  103690.alr3444
Domain Number 1 Region: 203-327
Classification Level Classification E-value
Superfamily post-AAA+ oligomerization domain-like 2.89e-23
Family DNA polymerase III clamp loader subunits, C-terminal domain 0.034
Further Details:      
 
Domain Number 2 Region: 42-200
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000106
Family Extended AAA-ATPase domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 103690.alr3444
Sequence length 329
Comment (Nostoc sp)
Sequence
MPIYVYWGEDDFAIAKAVTTLRDRVLDPLWTSFNYTSFPPEDGDAAIQALNQVMTPAFGA
GGRLVWLMNTNLLQNCPENVLAELTRTLSVIPENSFLLLTCHNKPDERLKSTKLLKQSAT
EFREFPLIPPWKTELLIQSVNQAAQTVGVKLTPKSAELLAEAVGNDTRLLYNEMEKLRLY
AEDSNRPIEENTVTRLVRNTTHNSLQLAAAIRVGDTAKALTILADLINAAEPELRIIATL
IGQFRTWLWVKLMVESGERNPQAIAQAAEIGNPKRIYFLQQEVQPLSLRQLISCLPLLLE
LEVTVKQGRAEISILQIKIIELCQLCQRI
Download sequence
Identical sequences A0A1Z4KJC4 Q8YRK2
103690.alr3444 gi|17230936|ref|NP_487484.1| WP_010997594.1.33676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]