SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 103690.asr1156 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  103690.asr1156
Domain Number 1 Region: 1-65
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000334
Family Anti-sigma factor antagonist SpoIIaa 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 103690.asr1156
Sequence length 70
Comment (Nostoc sp)
Sequence
MILDLSQIDFVDSSGLGALVQLAKQAQTAEGTLQIVTNARVTQTVKLVRLEKFLSLQSTV
DAAVENIKGA
Download sequence
Identical sequences Q8YXQ6
gi|17228651|ref|NP_485199.1| 103690.asr1156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]