SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI100079 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI100079
Domain Number 1 Region: 183-227
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000389
Family Retrovirus zinc finger-like domains 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI100079
Sequence length 538
Comment (Postia placenta MAD 698)
Sequence
MSSTLLFLDQFNAPSTEGGKRISIYTPKHTHVGDSTLLMLLLSNPTDVFNKLKTHHPEAT
NATDCAALEVYLSTRREYDEAVKAADEAIDHHKRLLRQQDDRVLTELIRLDNLKVAHRFQ
PLLPRSIQAQHNKFIPRAIPNAYLPLPAPLPTSTFRHPPISSPFLQATPQSTTIPADWQP
NPGWTPKGSCRRCRSSRHWVRDCPDIRCTRCGKEAPGHLERECGTRPMKRHVSTPPEEPA
RCVGVVVNNVFLEGIINEAKERKERERQTKVVPIPPPCSANPEPQASPIAGSSHPRPDTP
VVFRKVDPDWTPDTTPWTWDSSWPRQKHLSGEEWKNVGRNVHNEWFNKEEDDGIDWELYG
DGEQRRARAYGQHKVRMDPIIRKPQYGARVGACKTEGAGRKTYRDGGRTGTRVFCYTKGS
MRAKQNVAWHTDQEETNGKHTGILDNAGLEFQQFPLNFGACEDSVVLEQGCEQHGGPPAP
GYSRARAFELVPDHAGRRVSTHGWGDDVGQLLMNTRRLKYLPMTEIEVSPAWGDISGV
Download sequence
Identical sequences A0A1X6MMR7 B8PH02
XP_002474963.1.31404 104341.JGI100079 jgi|Pospl1|100079|fgenesh3_pg.132__24

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]