SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI100194 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI100194
Domain Number 1 Region: 183-227
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000254
Family Retrovirus zinc finger-like domains 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI100194
Sequence length 415
Comment (Postia placenta MAD 698)
Sequence
MSSTLSFLDQFNAPSTEGGKRLSIYTPKHTHVGNSTLLTLLLSNPTDVFNKLKAHNPEAT
NATDRAALEAYLSARREYDEAVKAADEAIDHHKRLLRQQDDRVLTELIRLDNLKVAHRFQ
PLLPRNIRARHNKFIPRAIPNAYLPLPAPLPTSAFRRPPIPSPFLQATPRSTTIPADWQP
NPGWTPKGSCRRCGSSRHWVRDCPDVRCAGCGKEAPGHLERECGTKPMKRHVSAPPEEPA
RRVGVVVDNVFLEEIINEAKEKKEKERQTKAVPIPPPRSANPEPPTSPVAGPSRPRPDTP
VVFRKVDPDWTPDTTQWTWDSSWPHQKHLSGEEWMNVGRNARKEWFDEEEDGVDWELYGD
GEQYIEHEVLSLPRPEKQGQSKACEMKCDRVATVATCLCSWWGRSEDGDTPRFLH
Download sequence
Identical sequences B8NZT6
104341.JGI100194 XP_002468904.1.31404 jgi|Pospl1|100194|fgenesh3_pg.2__92

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]