SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI100525 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI100525
Domain Number 1 Region: 380-440
Classification Level Classification E-value
Superfamily Cytochrome P450 0.000000076
Family Cytochrome P450 0.0062
Further Details:      
 
Weak hits

Sequence:  104341.JGI100525
Domain Number - Region: 182-219
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000143
Family Retrovirus zinc finger-like domains 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI100525
Sequence length 480
Comment (Postia placenta MAD 698)
Sequence
MSSTLSFLDQFNAPSTEGGKRLSIYTPKHTHVGDSTLLTLLLSNPTDVFNKLKAHNPEAT
NATDRAALEAYLSARRDYDEAVKAADEAIDHHKRLLRQQDDRVLTELIRLDNLKVAHHFQ
PLLPRSIRAQHNKFIPRAIPNAYLPLPAPLPTSAFRRPPIPSRFLQATPRSTTIPADRQP
NPGWTPKGSCRRCGSSRHWVRDCRKEAPGHLERECGTRPMKRHVSAPPEEPARRVGVVVD
NVFLEGIINEAKERKEKERQTKAVPIPPPRSANPEPPTSSVAGPLRPHPDTPVVFRKVDP
DWTPDTTQWTWDSSWPHQKHLSGEEWMNVGRNARKEWFDEEEDDGVDWELYGDGEQPNKD
TVLLLSEPIRGLDGKMIYEIPVAKGTEVLVGMWACNVNKSLWGEDSLEWKPERWLSDLPD
ALKQASVPGVYSNILYYAFSGFKFSEMEMMWNMGPVNYPTVGKDNNTPRLPLKVGVYQAP
Download sequence
Identical sequences B8P607
jgi|Pospl1|100525|fgenesh3_pg.31__22 XP_002471129.1.31404 104341.JGI100525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]