SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI100754 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI100754
Domain Number 1 Region: 399-431
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000089
Family Retrovirus zinc finger-like domains 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI100754
Sequence length 472
Comment (Postia placenta MAD 698)
Sequence
MSNISSTITSNNAVNPVPLGLPALAGSPLLQYDRADRCFVTSTKRAPIYPRGGTWCRATG
PNLQVVAHQELVSYYQRHPPTHPEDVFTTLRINVESTQTAESVQSPINEQPLELPEVQYV
PIEIPDIELPPAPPAPTNAPVEAPMATFTQADINQCITVALAAYQSQQSAANRPLCLDIP
APEPFSGKAEDLRRFIQCILSYFVATNNTRLSDEAKIAFTVALMRKDLGKTWADTYYKKS
AGGVQVYSTWADFVAALEEVFPEHGTRIKAHQILMKLPERQKDRKTALSLGNYVTRFEQL
ASKAQLKDAEVNGTNRVENDYHTLHANFVKGLPKELYFALATRAWYDEVRNTDAAKQGAL
VVTDTRDYGKPMDIDAAAVAATFASTSGGRKWELGAALNEADRKLHRDGNLCFYCHIKGH
SAKDCRKKAAARQGGGRPNQGGSGKDDFRARIKTLSADEKRELYEELTMEDF
Download sequence
Identical sequences B8P4I9
XP_002470599.1.31404 jgi|Pospl1|100754|fgenesh3_pg.21__107 104341.JGI100754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]