SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI100779 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  104341.JGI100779
Domain Number - Region: 235-256
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00523
Family Retrovirus zinc finger-like domains 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI100779
Sequence length 256
Comment (Postia placenta MAD 698)
Sequence
MSSPAAIPDKETLKLLLPLRYDGKTVIECNRFLSQLRIYWLINTSLTTIELKVQVALSLL
DGDARAWATPYFAQLVSVQIGVQGVTTPFANEAAFAAAFRARFGNLDDEAAAQVELAKLC
ADKSVREKRTAAEFSALFKGPADRSGYGDLELRDKYLSGIPSRVYRKIELETFTTWQDAD
KRATEVEQILDISQARRPELNNFFSARGRGRGGARGGAPSTHAASASINAAVGKGNFPGT
CFGCGKQGYRRFECPN
Download sequence
Identical sequences B8PPN1
104341.JGI100779 XP_002477636.1.31404 jgi|Pospl1|100779|fgenesh3_pg.1267__1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]