SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 104341.JGI100817 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI100817
Domain Number 1 Region: 183-227
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000558
Family Retrovirus zinc finger-like domains 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI100817
Sequence length 300
Comment (Postia placenta MAD 698)
Sequence
MSSTLPFLDQFNAPSTEGGKRISIYTPKHTHVGDSTLLTLLLSNPTDVFNKLKTHHPEVT
NATDCAALEVYLSAHRKYDEAVKAADEAIDHHKWLLRQQDNCVLTELIRLDNLKVAHRFQ
PLLPRSIRARHNKFIPCTIPNVYLPLPTPLPASAFRRPPIPSPFLQAMPRSTTIPADWQP
NPGWTPKGSCRQCGLSRHWVRDCPDIRCARCRKEAPGHLERECGTRPMKRHVSAPPEEPA
RRVGVVVDNVFLEGIINEAKERKERERQTKADSSWPCQEHLSGEEWKNVGRNARNEWFDE
Download sequence
Identical sequences B8PFJ2
jgi|Pospl1|100817|fgenesh3_pg.113__38 XP_002474448.1.31404 104341.JGI100817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]