SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI100955 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI100955
Domain Number 1 Region: 58-89
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000392
Family Retrovirus zinc finger-like domains 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI100955
Sequence length 121
Comment (Postia placenta MAD 698)
Sequence
MKAWYDEVRNADAAKQGALVITDTRDYGEPMDIDAAAVASTFASTSGGRKWELGAILNEA
DQKLHRDGNLCFYCHIKGHSAKDCHKKAAARQGGGRPNQGGSGKDDFCARIKTLSADEKR
E
Download sequence
Identical sequences 104341.JGI100955 jgi|Pospl1|100955|fgenesh3_pg.293__1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]