SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI101060 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI101060
Domain Number 1 Region: 259-439
Classification Level Classification E-value
Superfamily Cysteine proteinases 3.53e-23
Family Adenain-like 0.0051
Further Details:      
 
Domain Number 2 Region: 970-1001
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000698
Family Retrovirus zinc finger-like domains 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI101060
Sequence length 1043
Comment (Postia placenta MAD 698)
Sequence
LRTGFNNWVVEYERIAATGPVWTTWAFPMERYCGRLLPGVRSRRFPYASIDNFIIERAHL
TQVKLLYGLHEELRLQPPTSDAGELSVPEYPHSRLVPPSVSDEVSADLHTKIAVCLATRF
GKTMRIARKHVPHVLMQYGKVRRLGGGDMIHARELVPVREDTRDASFVRYQLRVDKNARH
KNLPTQFVDCDFFGQLLRLVVLSLAPSSFRELGLQDPETLILAVIRTCMTWETPIHVSIN
DTPHFLQAMAPVLSQSLQSNVHLDASDMSRLQNRSAWMNDSCINACMQLLQLVFLGPEVR
ADAGNATLWRNAASTRFWEKDVWTIPIHYEDHWMLVTIDIPRLRVAYFDSFAREHPWEGH
IQDIMQLTMRLLNIAVDKGHHIVHAQRAWAMYLTTTAARQHNTYNCGVWILAIITAVLCG
YDMMGFEEADIGRFRIFLFTLACAVSTSQKTSLAANSAWVDVTICMSNLPMLPHIGEVLL
YQPSQFIQPPFVPQQGIGQGAFQNAAGVQMFPGDVQACWRAKHTKLEALQAQKQPVYDFQ
LDQWTLIRVGIGCSTRYRSPRSVIASTEERSMYGHLMPVQIPVTNLGHTKSRPKNHQWCI
STQFLWDYQPSQDHHSSSMTEQIAASSPPQRGLPYTLEAAPGVVLPVQTRRSSPTKNSSA
TTRDTHPLIQKTYSPPYGSTSNLHKQQKVCSHPSTNNHSNSLKFNIELPPAPPAPTNAPV
EVPMATFTQEDIDQRITVALAAYQSQQSTANRPLRLNIPAPEPFSGKAEDLRRFIQCILF
YFVATNNTRLSDEAKIAFTVALMRKDLGKTWADTYYEKSAGGVQVYSTWADFVAALEEAF
PEHGTKTVLSLSNYVTRFEQLASKAQLKDTEVNGTNRVENDYHTLHANFIKGLPKELYFA
LATRVARDRPNTMKAWYDEVRNTDAAKQGALIVTDTRDYGEPMDIDAAAVASTFASTSGG
RKWELGAALNEANRKLHRDGNLCFHCHIKGHSAKDCRKKAAARQGGGRPNQGGSGKDDFR
ARIKTLSADEKRELYEELTMEDF
Download sequence
Identical sequences B8P1R9
jgi|Pospl1|101060|fgenesh3_pg.9__1 104341.JGI101060 XP_002469624.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]