SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI101442 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI101442
Domain Number 1 Region: 1113-1196
Classification Level Classification E-value
Superfamily Acid proteases 0.0000304
Family Retroviral protease (retropepsin) 0.048
Further Details:      
 
Weak hits

Sequence:  104341.JGI101442
Domain Number - Region: 238-258
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0136
Family Retrovirus zinc finger-like domains 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI101442
Sequence length 1231
Comment (Postia placenta MAD 698)
Sequence
MSSPAAAPDKEMLKLLLPLCYDGKSVVECNRFILQLLIYWTINTALSTIELKVRVALSLL
DGDAQAWATPIFAQLAAVQIQIQGATSPFAYEAAFLMAFKARFGNLDDKAAAQVELAKLC
VDKSVHEKRTAAEFSTLFKGLADHSGYGDLELRDKYLSGIPSRVYRKIELETFTTWLEAE
KRATEVEQILDISRARRPELNNFFSARGRGRGGARGGMPQSHGASASINAAVGKGDFPGS
CFGCGKQGYQRFECPNWPLDATRPSARLAPSHTEVAGLSRLGIEPRGMPSRRLLVRSGHM
FLFISAFGMTSLHRWTWFPKTSPVVTHSQAREAASRSAAENLDSSSRTQSTPFPTIPGNF
DCDEEDEIDQELQDDFDEEPIPSTAEERTSSPELLGLTTSDYDISTPDLFERSSSSPEPE
DPIPATSNIVLPTPSSFHAHAQPPIASSSRLSVIPTSDLAPPPPLAPSNAASNSNAAPPA
PTIPSTTTASSSSPAPTNTTNMSQNTNTPLMPPRGHSTAPSFDPSEVRSLRRYFQDLEVL
FTRCQITDEAAKKQWAVRYPSIDVADLWETIESFIDVAKSYNDWKADVQALYPGADDTRK
WSLADMDQLIGERACIGIHNAADLGCYYRDFMAITKHLIAQHRLSTIEQSRAFLRGFQPA
LLTRLETQLHLKHPDHYADDPYTMAEIHAAATFILHGTSSTPTTAANQAIASTSNTSTTV
PSGMIKTEDISMIIESLSRTIATLIQPTTHATHNHAPAPRQQAAVHVHENSGAEQTCHYC
GNRGCRVGTCEFAEINIRDGKCKRNTDGKIVLPNGSFCPRTIPGLTIRDRIYKWHRRNPA
APTALTMLFEIDDRSTMQTFTLNTSSRIEALERELLQLRKRREVFDGIKILQRKKPTTPV
VTRSTEASGSGTSKGVAAPPSTSTSTAPPPTIPAAAPAPSSSSPTQSTSRPTTMSAPPAP
PVHPFANARDATYTPPNVQNFATPPKPSNDKGKEPAYKTIVPCSMKSQFVMLTPEELLSI
APNVRNKYRDAVTPKRVSTEPIASAHIVEIGADEVTAVNQLSCSGATLEPGATIVPDPYE
TYLKHIPHSEHPAEFTVARDSNAIRLIIALVDNKEQIECIVDPGSQIVAMSEEVCLGLNL
LFDPTIQLNMQSANGEVDRSLGLIRNVPFHIGEIVLYLQAHVIRNAAYDILLGRPFDMLT
QSVVKNFADKNQTITILCPNTGKTVTIPTYA
Download sequence
Identical sequences B8PAQ1
jgi|Pospl1|101442|fgenesh3_pg.63__61 104341.JGI101442 XP_002472740.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]