SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI101456 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI101456
Domain Number 1 Region: 147-191
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000299
Family Retrovirus zinc finger-like domains 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI101456
Sequence length 492
Comment (Postia placenta MAD 698)
Sequence
MPTRPRGPAPYQLVTLKAHNPEATNATDRAALEAYLSARREYNKAVKAADEAIDHHKRLL
RQQDDRVLTELIRLNNLKVAHRFQPLLPRSIRARHNKFIPHAIPNAYLPLPAPLPTSAFR
RPPIPSPFLQATPRSTTIPADWQPNPGWTPKGSCRRCGSSRHWVRDCPDVRCAGCGKEAP
GHLERECGTRPMKRHVSAPPEEPARRVGVVVDNVFLEGIINEAKERKKKERQTKAIPIPP
PRSANPEPPASPVAGPSRPRPDTPVVFRKVDPDWTPDTTQWTWDSSWPNQKHLSGEEWMN
VGRNARKEWFDEEEDDGVDWELYGDGEHSGNMYGIICKNEVYIDIPKLVKYTSGESNVEM
LKGLCVTREAALWEYCEVKITQRLASMLDESIESDIYASCYTQGRYQPSRDTLQTATGAG
LNEEVVHGLMIRIGQKAQCCKYPGIDGSPNNSDVTEMNPLEPWERADEAPKGQDRRERDI
IEKEAFDVVEAG
Download sequence
Identical sequences B8PAR5
XP_002472775.1.31404 104341.JGI101456 jgi|Pospl1|101456|fgenesh3_pg.63__75

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]