SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI101974 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI101974
Domain Number 1 Region: 183-227
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000194
Family Retrovirus zinc finger-like domains 0.003
Further Details:      
 
Weak hits

Sequence:  104341.JGI101974
Domain Number - Region: 43-91
Classification Level Classification E-value
Superfamily TPR-like 0.00269
Family CT2138-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI101974
Sequence length 374
Comment (Postia placenta MAD 698)
Sequence
MSSTLLFLDQFNAPSTEGRKRISIYTPKHTHVGDSALLTLLLSNPTDVFNKLKTHNPEAT
NATDRAALGAYLSARHEYDEAVKAADKAIDHHKRLLRQQDDRVLTKLIRLDNLKVAHRFQ
PLLPRSIRAQHNKFIPRTIPNAYLPLPAPLPTSAFRCPPIPSPFLQATLQSTTIPADWQP
NPGWTPKGSCRRCGSSRHWVRDCPDVRCAGCGKEAPGHLERECGTRPMKRHISAPPEEPA
RRVGVVVDNMFLEGIINEVKERKEKERQTKAVSIPPPRSANPEPPASPVAGSSRPRPDTP
VVFRKVDPDWTPDTTQWTWDSSWPHQKHFSGEEWKNEVRNQGKIKVVQEMWDFTDVRDSA
SNRTVGHGKGNYIE
Download sequence
Identical sequences B8P864
jgi|Pospl1|101974|fgenesh3_pg.44__55 104341.JGI101974 XP_002471849.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]