SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI102340 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI102340
Domain Number 1 Region: 229-261
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000314
Family Retrovirus zinc finger-like domains 0.0037
Further Details:      
 
Domain Number 2 Region: 476-520
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000325
Family Retrovirus zinc finger-like domains 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI102340
Sequence length 657
Comment (Postia placenta MAD 698)
Sequence
MLTRPRGPAEDLRRFIQCVLSYFVATNNTRLSDEAKIAFTVALMRKDLGKTWADAYYEKS
AGGVQVYSTWANFVAALEEAFPEHRTRIKAHQILMKLPERQKDRKTALSLGNYVTRFKQL
ALKAQLKDTEVNGTNCVENDYHTLHANFVKGLPKELYFALATRVARDRPNTMKAWYDEVR
NTDAAKQGALIVTDTRDYGKPMDIDAAAIASTFTSTSGGRKWELGAVLNEADRKLHRDGN
LCFYCHIKGHSAKDCRKKAAARQGGGRPNQGGSGKDDFCARIKTLSADEKQELMSSTLSF
LDQFNAPSTEGGKRLSIYTPKHTHVGDSTLLTLLLSNPTDVFNKLKAHNPEATNATDRAA
LEAYLSARREYDEAVKAADEAIDHHKRLLRQQDDCVLTELIRLDNLKVAHRFQPLLPCNI
WARHNKFIPRAIPNAYLPLPAPLPTSAFRRPPIPSPFLQATPRSTTIPADWQPNPGWTPK
GSCRRCGSSRHWVRDCPDVRCAGCGKEAPGHLERECGTKPMKRHVSAPPEEPARRVGVVV
DNVFLEEIINEAKERKEKERQTKAVPIPPPRSANPEPPTSPVAGPSRPRPDTPVVFRKVD
PDWTPDTTQWTWDSSWPNQKHLSGEEWMNVGRNAHKEWFDEEEDNGVDWELYGDGEQ
Download sequence
Identical sequences B8P8V1
XP_002472114.1.31404 104341.JGI102340 jgi|Pospl1|102340|fgenesh3_pg.49__63

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]