SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI102345 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI102345
Domain Number 1 Region: 183-227
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000224
Family Retrovirus zinc finger-like domains 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI102345
Sequence length 412
Comment (Postia placenta MAD 698)
Sequence
MSSTLLFLDQFNAPSTEGGKRISIYTPKHTHVGDSTLLTFLLSNPTDVFNKLKAHNPKAT
NATNCAALEAYLSARREYDEAVKAADEAIDHHKRLLRQQDDRVLTELIRLDNLKVAHRFQ
PLLPRSIRARHNKFIPCAIPNAYLPLPAPLPTSAFRRPPIPSPFLQATPRSTTIPADWQP
NPGWTPKGSCRRCGSSRHWVRDCPDVRCAGCGKEAPGHLERECGTRPMKQHVSAPPEEPV
RRVGVVVDNVFLEEIINEAKERKEKERQMKAVPIPPPRSANPEPPTSPIAGPSRPRPDTP
IVFRKVDPDWTPDTTQWTWDSSWPHQKHLSGEEWKNVGRNVRKEWFDEEEDNGVDWELYG
DGEHDPLNASTSLLLQQAAGANAGSARSQCVVTGRCRKRDADINSVSRLFIW
Download sequence
Identical sequences A0A1X6N057 B8P8V4
jgi|Pospl1|102345|fgenesh3_pg.49__68 XP_002472092.1.31404 104341.JGI102345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]