SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI102754 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI102754
Domain Number 1 Region: 265-297
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000855
Family Retrovirus zinc finger-like domains 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI102754
Sequence length 527
Comment (Postia placenta MAD 698)
Sequence
MATFTQADIDQRIAVALAAYQSQQSTANRPLRLDIPAPKPFSGKAEDLRRFIQCILSYFV
ATNNTRLSDEAKIAFTVALMRKDLGKTWADAYYEKSAGGVQVYPDWAAFATALEEAFPEH
GTRIKAHQILMKLPERQKNKKTVLSLGNYVTRFEQLASKAQLKDAEVNGVNRTENDYHTL
HANFVKGLPKELYVSLATRVARDRPNTMKAWYDEVRNADAAEQGALTVTDTRDYGEPMDI
DAAAVAATFASTSGGRKWELGAVLNEADRKLHRDGNLCFYCHIKGHSAKDCRKKAAARQG
GGRTNQGGSGKDDFRARIKTLSADEKRELLATQPWLDPEGKLQAMRIVSTLGCGKEAPGH
LERECGTRPMKRHVSAPPEEPARRVGVVVDNVFLEGIINEAKERKEKERQTKAIPIPPPR
SANPEPPASPVAGPSRPRPDTPVVFRKVDPDWTPDTTQWTWDSSWPNQKHLSGEEWMNVG
RNARKEWFDKEEDDGVDWELDGDGEHLHNGVRAHFVPGIVPLRFFLH
Download sequence
Identical sequences B8PMG1
104341.JGI102754 jgi|Pospl1|102754|fgenesh3_pg.265__7 XP_002476863.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]