SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI102903 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  104341.JGI102903
Domain Number - Region: 183-226
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0419
Family Retrovirus zinc finger-like domains 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI102903
Sequence length 385
Comment (Postia placenta MAD 698)
Sequence
MSSTLSFLDQLNAPSTEGGKRISIYTPKHTHVGDSTLLTFLLSNPTEVFNKLKTHNPEAT
NATDRTTLEAYLSARHEYDEAVKAADEAIDHHKRLLRQQDDRVLTELIRLDNLKVAHHFQ
PLLPRSIQARHNKFIPRAIPNAYLPLPTPLPTSAFRRPPIRSPFLQATPQSTTIPADWQP
NPGWTPKGSCRRCGLSRQWVRDCPDVRCAGCRKEAPGHLEWECGTRPMKRHVSTPPEEPA
RHVGVVVDNVFLEGIINEAKERKERERQTKAVPIPPPRSANPEPPTSPIVGPSRPRPDTP
VVFCKVDPDWTPDTTQWTWDSSWPRQKHLSGEEWKNLGRNACNEWFDEEEDDGIDWELYG
DGEHLHNGVRAHFVPGIVPLRFFLH
Download sequence
Identical sequences B8P8X1
XP_002472121.1.31404 jgi|Pospl1|102903|fgenesh3_pg.50__30 104341.JGI102903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]