SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI102987 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI102987
Domain Number 1 Region: 276-305
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000068
Family Retrovirus zinc finger-like domains 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI102987
Sequence length 347
Comment (Postia placenta MAD 698)
Sequence
MFRDLRTRHREDRAELRVSVAHRRRCRRTSKAKSKCWETESKCRAGCECRKEVNRGPEGL
GAYHRLDILAPEPFSGKVEDLRCFLQCILSYFVATNNTRLSNEAKIAFTVALMRKDLGKT
WADAYYEKSAGGVQAHQILMKLPERQKNKKTAPSLGNYVTRFEQLASKAQLKDAEVNGVN
RTENDYHTLHANFVKGLPKELYVSLATRVARDRPNTMKAWYDEVRNADAAEQGALTVTDT
RDYGEPMDIDAAAVAATFSSTSGGRKWELGAVLNEADWKLHRDGNLCFYCHIKGHSAKDC
CKKAAARQGGGGPNQGGSGKDDFRARIKTLSADEKRELYEELTMEDF
Download sequence
Identical sequences B8P5K2
104341.JGI102987 jgi|Pospl1|102987|fgenesh3_pg.28__22 XP_002470953.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]