SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI103218 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI103218
Domain Number 1 Region: 145-189
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000419
Family Retrovirus zinc finger-like domains 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI103218
Sequence length 706
Comment (Postia placenta MAD 698)
Sequence
MPSTNNPTDVFNKLKTHHPEVTNATNRTALEVYLSAHHEYDEAVKAADEAINHHKRLLRQ
QDDRVLTELIRLDNLKVAHCFQPLLPHSIQMRHNKFIPRAIPNAYLPLPAPLLMSAFRCP
PIPSPFLQAMPQSTIILADWQPNPGWTPKGSCRRCGSSRHWVRDCPDIQCTRCRKEAPGH
LERECETRPMKRHISAPPEEPARRVGVVVDNVFLEGIINKAKERKERERQMKAVPIPPPR
SANPEPQASPIAGSSRPRPDTPVVFRKVDPDWTPDTTQWTWDSSWDSSWPRQEHLFGEEW
KNVGRNARNEWFDEGEDNSVDWELYGDGEHRSNPKFDLVIHSSLCSSSLGVVVILDFLAQ
SSGQRTVHKPSLVVYESGIGSTQFLWDYQPSQDHHSSSTTEQIAASSPPQKELPSTLEAA
PGVVQPVQTRRSSPIKNLLATTRDTHLLTQKTYSPPYGSTSNLHKQRKACNHPSTNNHSN
SLKFNIELPQAPPAPTNAPVEVPMATFTQADIDQRIAVALAAYQSQQSTANRPLRLDIPA
PEPFSGKAEDLRRFIQCILSYFIATNNTRLSDEAKIAFTVALMRKDLGKTWADAYYEKSA
GGVQVYSTWADFVAALEEAFPEHGTRIKAHQILMKLPERQKDRKTVLSLGNYVTRFEQLA
SKAQLKDAEVNGTNRVENDYHTLHANFVKGLPKELYFALATRVARD
Download sequence
Identical sequences B8PMS4
104341.JGI103218 XP_002476981.1.31404 jgi|Pospl1|103218|fgenesh3_pg.282__8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]