SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI103235 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI103235
Domain Number 1 Region: 310-341
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000759
Family Retrovirus zinc finger-like domains 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI103235
Sequence length 390
Comment (Postia placenta MAD 698)
Sequence
MTEQIAASSPPQKELPSTLEAAPGVVQPVQTRRSSPIKNSLATTRDTHPLTQKTYSPPYG
SMSNLHKQQKACSHPSTNNHSNSLKFTPPAPTNAPVEVPMATFTQADIDQRIAVALAAYQ
SQHGKAEDLRRFIQCILSYFVATNNTRLSDEAKIAFTVALMRKDLGKTWADAYYEKSAGG
VQKDRKTVLSLGNYITRFEQLASKAQLKDAEVNGTNRVENDYHTLHANFVKGLLKELYFA
LATRVARDRPNTMKAWYDEVQNADAAKQGALVITDTRDYGEPMDIDAAAVASTFASTSGG
RKWELGAVLNEADRKLHRDRNLCFYCHIKGHSAKDCHKKAAARQGGGRPNQGGSGKDDFR
ARIKTLSADKKRELYNDTTYETLTPNLGAT
Download sequence
Identical sequences B8PBG0
jgi|Pospl1|103235|fgenesh3_pg.70__11 XP_002473009.1.31404 104341.JGI103235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]