SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI103308 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI103308
Domain Number 1 Region: 341-373
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000715
Family Retrovirus zinc finger-like domains 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI103308
Sequence length 414
Comment (Postia placenta MAD 698)
Sequence
MSNNSSTITSNNAVNPVPLGLPALAGSPLLQYDQADRCFVTTTRRTPIYPRGGSWVHAEG
SNPQIIAHQQLVSYYQRHPPAHPEDVFATLRINVEPAQITENLQSPVNEQSFELPDVHGK
AEDLRRFLQCVLSYFVATNNTRLSDEAKIAFTVALMRKDLGKTRADAYYEKSAGGVQVYP
DWAAFATALEEAFPEHGTRIKVHQILMKLPERQKNKKTALSLGNYVTRFEQLASKAQLKD
AEVNGVNRTENDYHTLHANFVKGLPKELYVSLATRVARDRPNTMKAWYDEVRNADAAEQG
ALTITDTRDYGEPMDIDAAAVAATFAPTSGGRKWELGAVLNEADRKLHRDGNLCFYCHIK
GHSAKDCRKKAAARQGGGRPNQGGSGKDDFRARIKTLSADEKRELYEELTMEDF
Download sequence
Identical sequences B8PJ32
jgi|Pospl1|103308|fgenesh3_pg.166__24 XP_002475687.1.31404 104341.JGI103308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]