SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI103587 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI103587
Domain Number 1 Region: 538-569
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000115
Family Retrovirus zinc finger-like domains 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI103587
Sequence length 611
Comment (Postia placenta MAD 698)
Sequence
MLIYIVNHAGGQETKHNTDSSTGHPTICSPRHAYLSLHSTISVPAVLAVMKGLVGPILHI
DDMEFYNLMFLNPIDELLCSSPLHAVTASYKGFEYGVQKAALRAQRTEANGWAASRHKRA
VNKALFGEYYEPSNNSTTITSNNAVNPVPLGLPALAGSPLLQYDRADRCFVTTTRRTPIY
PRGGSWVHAEGSNPQIVAHQQLVSYYQRHPPAHPEDVFAILRINVEPAQTTENPQSPVNE
QPFELPDVQYVPIEAPELPPAPPAPTNAPVEAPMATFTQADIDQRIAVALAAYQSQQSTA
NRPLRLDIPAPEPFSGKAEDLRRFIQCILSYFVATNNTRLSDEAKIAFTVALMRKDLGKT
WADAYYEKSAGGVQVYPDWAAFATALEEVFPEHGTRIKAHQILMKLPERQKNKKTVLSLG
NYVTRFEQLASKAQLKDAEVNGVNRTENDYHTLHANFIKGLPKELYVSLATRVARDRPNT
MKAWYDEVRNADAAEQGALTVTDTRDYGEPMDIDAAAVAATFASTSGGRKWELGAVLNEA
DRKLHRDGNLCFYCHIKGHSAKDCRKKAAARQGGGRPNQGGSGKDDFRARIKTLSADEKR
ELYEELTMEDF
Download sequence
Identical sequences B8P0H8
XP_002469146.1.31404 jgi|Pospl1|103587|fgenesh3_pg.4__199 104341.JGI103587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]