SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI103640 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  104341.JGI103640
Domain Number - Region: 379-407
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0136
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI103640
Sequence length 495
Comment (Postia placenta MAD 698)
Sequence
MWHFSASAACALPLRRMSTPATAQRKPAPRLPRPAARYWKGKAPKGAGEALSSDDSDYDA
EQEQEPEEEGDVLIQDVQQDDDEDALDVQKPQKAAAAKGRAMNVALKDVNISKEGRVIVA
GKEEVGRTGAELEEEEEEEEEAEAEEEEEEESSEEESEEEKPKLQFRPVFIPKRARATIA
EKEAMAEDTEEAVRKKELEAEERKKQSHDMVAESIRRELAEKEKEIETPDVDDTDGLDPT
TEFEAWRLRELARIKRDKEAALARELEREEVERRRALPEEQRLREDLERAEQSRKDKPKG
QQKFLQKYWHKGAFHQDEEILRRHDFTEATESTMDVSLLPQVMQVKNFGKRGRTKYTHLL
DQDTTVASGGFGGTAPVKAGGTSTAGGGCFVCGGPHLKKDCPQAKDLPPPGRIGTGANST
ATGSRQWGARPDKDKEDGGSWRNRDRDNDRRPNGDDRDRRRGDDREGYRDRDRQEAAVAF
TVEVTFATATRAVAG
Download sequence
Identical sequences B8PGN1
104341.JGI103640 jgi|Pospl1|103640|fgenesh3_pg.127__42 XP_002474824.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]