SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI103771 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI103771
Domain Number 1 Region: 288-317
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000121
Family Retrovirus zinc finger-like domains 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI103771
Sequence length 320
Comment (Postia placenta MAD 698)
Sequence
MSNHSNFLKFTPPAPTNALVEIPMASFTQEDIDQRIAVALTAYQSQQSTANRPLRLDIPA
PEPFSGKAEDLRRFIQCILSYFVATNNTRLSDEAKIAFTVALMRKDLGKTWADAYYEKSA
GGVQVYSTGATFVTGLEEAFPEHGTRIKAHQILMKLPERQKDRKTALSLGNYVTRFEQLA
SKAQLKDAKVNGTNRVENDYHTLHANFIKGLPKELYFALATRVARDRPNTMKAWYDKVRN
ADAAKQGALIITDTRDYGEPMDIDAAAVASTFASTSGGRKWELGAVLNKANRKLHRDGNL
CFYCHIKGHSAKNCCKKAAA
Download sequence
Identical sequences B8PM43
jgi|Pospl1|103771|fgenesh3_pg.246__6 XP_002476748.1.31404 104341.JGI103771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]