SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI104006 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI104006
Domain Number 1 Region: 434-466
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000767
Family Retrovirus zinc finger-like domains 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI104006
Sequence length 507
Comment (Postia placenta MAD 698)
Sequence
MGSVRTSYRVSYHYISFFTNTTTQIQWSSNNSSTITLNNAVNPVPLGLPALAGSPLLQYD
RADHCFVTSTKRAPIYPRGGSWVRAEGSNPQIVAHQQLVSYYQRHPPAHPEDVFATLQIN
VEPAQTTENLQSPVNEQPFELPDVQYVPIEAPELPPAPPAPTNAPVEVPMATFTQADIDQ
RIAVALAAYQSQQSTANQPLRLDIPAPEPFSGKAEDLRRFIQCILSYFVATNNTRLSDEA
KIAFTVALMRKDLGKTWADTYYEKSAGGVQVYPDWTAFATALEEAFPEHGTRIKAHQILM
KLPERQKNKKTALSLGNYVTRFEQLASKAQLKDAEVNGVNRTENDYHTLHANFVKGLPKE
LYVSLATRVARDRPNTMKAWYDEVRNADAAEQGALTVTDTRDYGEPMDIDAAAVAATFAS
TLGGRKWELGAVLNKADRKLHRDGNLCFYCHIKGHSAKDCRKKAAARQGGGRLNQGGSGK
DDFRARIKTLSADEKRELYEELTMEDF
Download sequence
Identical sequences A0A1X6N1E2 B8PFS6
jgi|Pospl1|104006|fgenesh3_pg.116__36 104341.JGI104006 XP_002474514.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]