SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI104529 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI104529
Domain Number 1 Region: 471-503
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000011
Family Retrovirus zinc finger-like domains 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI104529
Sequence length 544
Comment (Postia placenta MAD 698)
Sequence
MSTCDMNGCKDRLCGLLAVFVTGRVYYCPVSAGTAVAKVVEIRLLKGYNINHGRGTFFPA
VVTSNISSTITSNNAVNPVPLGLPALAGSPLLQYDRADRCFVTSTKRAPIYPRGGTWCRA
TGPNPQVIAHQELVSYYQRHPPAHPEDVFTILRIDVEPTQTAESVQSPINEQPLELPEVQ
YIPIEIPDIELPPAPPAPTNAPVEVPMATFTQADIDQRIAVALAAYQSQQSTANRPLRLE
IPAPEPFSGKAEDLRHFIQCILSYFVATNNTRLSDEAKITFTVALMRKDLGKTWADAYYE
KSAGGVQVYSTWANFITALEEVFPEHGTRIKAHQILMKLPEQQRDRKTALSLGNYITRFE
QLASKAQLKDAEVNGTNRVENNYHTLHANFVKGLLKELYFALATRVTRDRPNTMKAWYDE
VRNADAAKQGALVVTDTRDYGEPMDIDAAAVASNFASTSGGRKWELGAVLNKADRKLHRD
GNLCFYCHIKGHSAKDCRKKAAARQGGGRPNQGGSGKDDFRARIKTLSADEKRELYKELT
MEDF
Download sequence
Identical sequences B8PAV0
XP_002472817.1.31404 jgi|Pospl1|104529|fgenesh3_pg.64__50 104341.JGI104529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]