SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI105169 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI105169
Domain Number 1 Region: 265-296
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000192
Family Retrovirus zinc finger-like domains 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI105169
Sequence length 1042
Comment (Postia placenta MAD 698)
Sequence
MATFTQADIDQRIAVALAAYQSQQSTANRPLRLDIPAPEPFSGKAEDLRRFIQCVLSYFV
ATNNTRLSDEAKIAFTVALMRKDLGKTWADAYYEKSAGGVQVYPDWTAFATALEEAFPEH
GTRIKAHQILMKLPERQKNKKTALSLGNYVTRFEQLASKAQLKDAEVNGVNRTENDYHTL
HANFVKGLPKELYVSLATRVARDRPNTMKAWYDEVRNADAAEQGALTVTDTRDYGEPMDI
DAAAVAATFASTSGGRKWELGAVLNEANRKLHRDGNLCFYCHIKGHSAKDCRKKAAARQG
GGRPNQGGSGKDDFRARIKTLSADEKRELRVWTPCGLELSLYCFSRMICYHVSEIPEMSA
FPVLFQVWMLMKQLSHIREDEERLLRIGNHHCNFSSAFCDSLSEMPKLLHLCEDEPREKS
YQVWAGMIDDSMLRVCGYDTEARERGKKKVSPNSQELEQKKDGDPWKRRAAYDFTACLAH
ADITYIVQSRYPLRITGFFEHNNGCQCTLLKRFPAIPLHPHVYEIAIRQLQQGASMNQVR
DVNMSMFKASLYRGQTASRVMLNHRYEILPGDYSRLYRLHYRRTYDIDVSVPAEQNIHNW
LDKDSPHYKPLIHTSVFYYAARAAQNERLKVFIATPEMRDAAWMYCHHQQVVLDGTFGLC
TSRLLLWIAMGINKRGQGVPVALFLFSAPTGNQATHAGYDTSILTELLKKWHEWLGKRNN
QDFEPYVGMTDTDTKERGALVTVWRNIILLLCKFHVRQCWTNKRSSLLSKLTGFWKTRVE
QELQQLEEVMLQTTEHAVALSLMDKARHDFSIISNDLEGKKAGAAGLSFLEYLQSTWMPV
ELWQSWSRRGREDAAAKMGTAIEAILPTTNHLESFNGTLKKRDIPQWQHSGHRLRFDVLV
YHLVMSILPRWLEQKELAIAYHFPTTITDAELTERQNHLWYGSHYERCITQPCGRSGVPN
TGEQLPAHMQTGPPTPELLHPHELVILPPVSHADDCASLEQEAELQALAANQGHQEPREN
NVQDNPVAAEATSGRTDNTEMQ
Download sequence
Identical sequences B8PM27
XP_002476732.1.31404 jgi|Pospl1|105169|fgenesh3_pg.243__4 104341.JGI105169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]