SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI105183 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI105183
Domain Number 1 Region: 183-227
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000649
Family Retrovirus zinc finger-like domains 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI105183
Sequence length 385
Comment (Postia placenta MAD 698)
Sequence
MSSTLPFLDQFNAPSTEGRKRISIYTPKHTHVGDSTLLTLLLSNPTDVFNKLKAHNPEAT
NATDRAALEAYLSARREYDEAVKAADEAIDHHKRLLRQQDDRVLTELIRLDNLKVAHRFQ
PLLPRSIRARHNKFIPRAIPNAYLPLPAPLPTSAFRRPPIPSPFLQATLRSTTIPADWQP
NPGWTPKGSCRRCGSSRHWVWDCPDVRCAGCGQEAPGHLERECGTRPMKRHVSAPPEEPA
RRVGVVVDNVFLEGIINEAKERKEKERQMKAIPIPPPHSANPEPPASPVAGPSCPRPDTP
VVFRKVDPDWTPDTTQWTWDSSWPNQKHLSGEEWMNVGRNARKEWFDEEEDDGVDWELYG
DGEHLHNGVRAHFVPGIVPLRFFLH
Download sequence
Identical sequences B8PEV6
104341.JGI105183 jgi|Pospl1|105183|fgenesh3_pg.106__7 XP_002474224.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]