SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI105422 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  104341.JGI105422
Domain Number - Region: 12-43
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0488
Family Retrovirus zinc finger-like domains 0.0057
Further Details:      
 
Domain Number - Region: 151-201
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 0.0536
Family Restriction endonuclease BsobI 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI105422
Sequence length 203
Comment (Postia placenta MAD 698)
Sequence
MPRSTTIPADWQPNPGWTPKGSYIQCARCGKEAPGHLEQECGTRPMKRHVSAPPEEPARC
VGVVIDNVFLEGIINEVKERKERERQTKAVPIPPLRSANPEPQASPIVGSSCPHSNTPII
FRKVNPDWTPNTTQWTWDSPWPHQEHLSGEEWKNVGRNACNEWFDEEEDDGIDWELYGDG
EHLHNGVRAHFVPGNVPLCFFLS
Download sequence
Identical sequences B8PHY0
XP_002475285.1.31404 jgi|Pospl1|105422|fgenesh3_pg.146__4 104341.JGI105422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]