SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI105502 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI105502
Domain Number 1 Region: 382-415
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000034
Family Retrovirus zinc finger-like domains 0.0038
Further Details:      
 
Weak hits

Sequence:  104341.JGI105502
Domain Number - Region: 639-683
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000117
Family Retrovirus zinc finger-like domains 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI105502
Sequence length 1137
Comment (Postia placenta MAD 698)
Sequence
MQSTQFLWDYQPSQDHRSSSTTKQIAASSPPQKELPSTLEAAPGVVQPVQTRRSSPIKNS
LATTRDTHPLTQKTYSPPYGLTSNLHKQQKACSHPSTNNHSNSLKFTPPAPTNAPVEVPM
ATFTQADIDQRIAVALAAYQSQQSTANRPLRLDIPAPEPFSGKAEDLRRFIQCILSYFVA
TNNTRLSDEAKIAFTVALMRKDLGKTWADAYYEKSAGGVQVYSTWADFVAALEEAFPEHG
TRIKAHQILMKLPEQQKDRKTALSLSNYVTCFEQLASKAQLKDAEVNGTNRVKNNYHTLH
ANFIKGLPKELYFALATRVARDRPNTMKAWYDEIRNADAVKQGALVVTDTRDYGEPMDIN
AAAVTSTFASTSGGRKWEPGAILNEADRKLHRDGNLCFYCHIKGHSAKDCCKKAAARQGG
GRPNQGGSGKDDFRARIKTLSADEKRELRYIPTRTNMSSTLSFLDQFNAPSTEGGKRLSI
YTPKHTHVGDSTLLTLLLSNPTDVFNKLKAHNPEATNATDRAALEAYLSARREYDEAVKA
ADEAIDHHKRLLRQQDDRVLTELIRLDNLKVAHRFQPLLPRSIRAQHNKFIPRAIPNAYL
PLPAPLPTSAFRRPPIPSPFLQATPRSTTIPADWQPNPGWTPKGSCRRCGSSRHWVRDCP
DVRCAGCGKEAPGHLERECGTRPMKRHVSAPPEEPARRVGVVVDNVFLEGIINEAKGRKE
KERQTKAIPIPPPCSANPEPPTSPVAGPSRPRPDTPVVFRKVDPDWTPDTTQWTWDSSWP
NQKHLSGEEWMNVGRNARKEWFDEEEDDGVDWELYGDDDTQQLNEPAHGSFCMRCKDETT
RETDDTDARDTVMLVIHVASSFFLSVTILSVPNGCMQGGWSGHGVGVGMHDESRCTMLKN
IWIIYNIGIVKWDISIWSKMRDNVQHIRQASVIGMAVGGESCEPSRGLQMERPTGASNPN
LHLHPRMNKVNGYYQSFSAPDADPELDTDKGEDDQMSWIGDKLTSLIAEGQRALGKEVVV
MSEAPEDEEDNGMDDWVEEDGGRAQSSHGGLPPYSSRHGLPLLSASPRRDRFDLSSSHAT
SYAQSIPGFPHRRGREVSVESDRFASTSFQEDESAWQTPELWEAMERVRQRYRREHA
Download sequence
Identical sequences B8PI79
XP_002475383.1.31404 jgi|Pospl1|105502|fgenesh3_pg.151__3 104341.JGI105502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]