SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI105778 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI105778
Domain Number 1 Region: 398-429
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000117
Family Retrovirus zinc finger-like domains 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI105778
Sequence length 485
Comment (Postia placenta MAD 698)
Sequence
MSNNSSTITSNNAVNPVPLGLPALAGSPLLQYDRADRCFVTTTRRTPIYPRGSSWVRAEG
SNPQIVAHQQLVSYYQRHPPAHPEDVFATLRINVEPAQITENLQSPVNEQLFELPVVQYV
PIEAPDTEPPPVSFAPTNALVEPPMTTFTQADINQRIAAALDTYRLQQSTANRPLCLDIP
APEPFSGKAEDLRCFLQCILSYFVATNNTRLSDEAKIAFTADAYYEKSAGGVQVYPNWAA
FATALEEVFPEHRTRIKAHQILMKLPEQQKNKKTALSLGNYVTRFEQLASKAQLKDAEVN
GVNRTENDYHTLHANFVKGLPKELYVSLATRVARDRPNTMKAWYDEVRNADAAEQGALTV
TDTRDYGKPMDIDAAAVVATFASTLGGRKWELGAVLNEADRKLHRDGNLCFYCHIKGHST
KDCRKKAAARQGGGRPNQGGSGKDDFCARIKALSADEKRELKLVRAQHADAALGAVDNDA
SISGM
Download sequence
Identical sequences B8P272
104341.JGI105778 XP_002469739.1.31404 jgi|Pospl1|105778|fgenesh3_pg.10__86

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]