SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI105917 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  104341.JGI105917
Domain Number - Region: 187-227
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000174
Family Retrovirus zinc finger-like domains 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI105917
Sequence length 488
Comment (Postia placenta MAD 698)
Sequence
MSSTLSFLDQFNAPSTEGGKRISIYIPKHTHVGDSTLLTLLLSNPTDVFNKLKTHNPEAT
NATDRAALEAYLSARHEYDEAVKAADEAIDHHKRLLHQQDDCVLTELIRLDNLKVAHRFQ
PLLPHSIRARHNKFILRTIPNTYLPLPTPLPTSAFRQPPIPSPFLQATPRSTTIPADWQP
NPGWTLKGSCRRCGSSRHWVQDCPDVRCAGCGKEAPGHLERECGTRPMKRHISAPPEEPV
RCVGVVIDNVFLEGIINEAKERKEKERQMKAVPIPPPRSANPEPPASPITGPSRPRPDTP
IVFRKVDPDWTPDTTQWTWDSSWLNQKHLSGEEWKNMGRNARKEWFDEEEDDGVDWELYG
DGEHEAGGGASASPYSEGTQVMTLSVMGGRRTAREQRRWLWLFAGWTSGGYWRQFEGGGS
WERQRGSAGMQIEMPKDELVGTISDVDVDKVLGVEGMHKALTRSHDGGEEGEELVRAQHA
DAAPRAGK
Download sequence
Identical sequences B8PB45
104341.JGI105917 jgi|Pospl1|105917|fgenesh3_pg.66__55 XP_002472907.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]