SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI106442 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI106442
Domain Number 1 Region: 406-437
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000872
Family Retrovirus zinc finger-like domains 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI106442
Sequence length 480
Comment (Postia placenta MAD 698)
Sequence
MSNISSTITSNNAVNPVPLGLPALAGSPLLQYDRADRCFVTSTRRTPIYPRGGSWVRAEG
SNPQIVAHQQLVSYYQRHPPAHPEDVFAILRINVEPAQTTENLQSPVNEQPFELPDVQYV
PIEAPELPPAPPAPTNAPVEVPMATFTQADIDQRIAVALAAYQSQQSTANRPLRLDIPAP
EPFSGKAEDLRRFIQCILSYFVATNNTRLSDEAKIAFTVALMRKDLGKTWADAYYEKSAG
GVQVYPDWAAFATALEEAFPEHGTRIKAHQILMKLPERQKNKKTALSLGNYVTRFEQLAS
KALLKDAEVNGVNRTENDYHTLHANFVKGLPKELYVSLATRVARDRPNTMKAWYDEVRNA
DAAEQGALTVTDTRDYGEPMDIDAAAVAATFASTSGGRKWEPGAVLNEADRKLHRDGNLC
FYCHIKGHSAKDCRKKAAARLGGGRPNQGGSGKDDFRARIKTLSADEKRELYEELTMEDF
Download sequence
Identical sequences B8PEQ7
jgi|Pospl1|106442|fgenesh3_pg.104__45 104341.JGI106442 XP_002474151.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]