SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI106492 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI106492
Domain Number 1 Region: 183-227
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000393
Family Retrovirus zinc finger-like domains 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI106492
Sequence length 364
Comment (Postia placenta MAD 698)
Sequence
MSSTLSFLDQFNAPSTEGGKRLSIYTPKHTHVSDSTLLTLLLSNPTDIFNKLKAHNPEAT
NATDRAALEAYLSARCEYDEAVKAADEAIDHHKRLLRQQDNRVLTELIRLDNLKVAHRFL
PLLPRSIRARHNKFIPRAIPNVYLPLPAPLPTSAFRRPPIPSPFLQATPQSTTIPADWQP
NPGWTPKGSCRRCGSSRHWVRDCPDVRCAGCEKEAPGHLERECGTRPMKRHVSAPPEEPA
RHVGVVVDNVFLEGIINEAKERKQKERQTKAVPIPPPRSANPEPPASPVAGPSRPRPDTP
VVFRKVNSDWTPDTTQWTWDSSWPNQKHLSGEEWMNVGRNARKEWFDEEEDDGVDWELYG
DGEQ
Download sequence
Identical sequences B8P8I4
104341.JGI106492 XP_002472005.1.31404 jgi|Pospl1|106492|fgenesh3_pg.47__35

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]