SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI106672 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI106672
Domain Number 1 Region: 135-166
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000235
Family Retrovirus zinc finger-like domains 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI106672
Sequence length 198
Comment (Postia placenta MAD 698)
Sequence
MKLPERQKDRKTALSLGNYVTRFEQLASKAQLKDAEVNGTNRVENDYHTLHANFVKGLPK
ELYFALATRVARDRPNTMKAWYDEVRNTDAAKQGALVVTDTRDYGEPMDIDAAAIASTFT
STSGGRKWELGAVLNEADRKLHRDGNLCFYCHIKGHSAKDCHKKAAARQGGGRPNQGGSG
KDDFRARIKTLSADEKQE
Download sequence
Identical sequences jgi|Pospl1|106672|fgenesh3_pg.231__1 104341.JGI106672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]