SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI107668 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI107668
Domain Number 1 Region: 193-312
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.05e-23
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000265
Further Details:      
 
Domain Number 2 Region: 307-358
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000000942
Family Retrovirus zinc finger-like domains 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI107668
Sequence length 491
Comment (Postia placenta MAD 698)
Sequence
MWRPATREVTGTNDTPLGNRRRFGPAPVEETAPPQLAQPSPSAYPRPPPQSDRDSSRQDR
GETPSSTNGADPNAPRKRRSRWGDAKTEIPGLPTAIQANGVSQAHLDNYAIHLRLEEINR
KLRLNDFVPPERERSPSPPPTYDAHGRRTNTREVRYRKKLEDERIRLVDRAMKNDPNFRP
PVEYHQQKRSQRPSEKVYIPVKEFPEINFFGLLVGPRGNSLKKMERDSGAKISIRGKGSV
KEGKARPEQYAEDAEEDLHCLVTADTDDKVTLCVKLINKVIETAASTPEGQNDHKRNQLR
ELAALNGTLRDDENQICQNCGGVGHRKYDCPEQRNFTANIICRVCGSAGHMARDCTVNRD
PNVVHSPDPPPMKSGFDSEYASLMAELGESGKGPGGDSGRAPWAGSAGHDITAGGSNIPP
WRRPEVWQSSALPNPQNNGYRPPQTPYAGYGAPASGGYSATAPGQQWGDYAASYAQYYQN
QYSQQAGTPAN
Download sequence
Identical sequences jgi|Pospl1|107668|estExt_fgenesh3_pm.C_870007 104341.JGI107668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]