SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI113887 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI113887
Domain Number 1 Region: 688-919
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000000000141
Family Voltage-gated potassium channels 0.013
Further Details:      
 
Domain Number 2 Region: 1138-1291,1334-1410
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000000369
Family Voltage-gated potassium channels 0.02
Further Details:      
 
Weak hits

Sequence:  104341.JGI113887
Domain Number - Region: 448-520,580-646
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000196
Family Voltage-gated potassium channels 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI113887
Sequence length 1479
Comment (Postia placenta MAD 698)
Sequence
MLDDDPFASPTEEDYVNDLPYRPPRSRYQDTTGAFPTAQVGPSSVSLISEFRGSVDGQRE
DDEARLTSNMSRAGMASGWSSSGGSDPELSGAGSSARRRKVRYSTSPSPFKKSGYTLKAM
SLSLRRASIRVVNFAGFGLEDHVRLAEVSADSEDTLTGKAEAGEDDVDEEDAALPDLSKS
LPIRGRTLGCLGPTSRIRMAMYRLLVWPWTEPIILLLIIFNAVVLTIQAHRSLALAADGS
QNPPQIKGYFHAWEDYTLFSLFCFFTLEAFARIAVSGFLLDPEIPTSSLLSSFSFSAHVD
SSIPNTHLEQATALAPHPSISHTHSPYASSQQRHNVPQRLQYLLTNLARPFTLRHSTMSL
PREPPPISSSSHTQRSPSHARSDTVQSRTPMMDKAFSKLQDMHSHIRNPSEPTIFSTALR
SDNPDVLALPFRLSIAHARVQTQRNVPYLRHSWSRIDFVAIVGFWVSFVLATADDHAIVE
NGTAPACERRIFRLLCYDSLLVSVIIGIQAFKGSYLRSCNVLPTLGESLTDTGQNCGGYI
NSTTLQVMGYLKQDGTYGPSKGYICSAGQICMDSMNPESNIESFDTIYYSALQVFIVASS
NGWSPIMYNMMDAEFFVSCLFFITCIVVLNFWLINLFVAVITNTFSAIRLGTKKSAFGAA
SIAPVIDDNDEGWTLVDGRRAARRTRIKQVYESIRWCWVALALTSLVLQATRTVEMGDAH
ATILDLGELVLTVAFDIEIVVRIVAELPDWRAFFVRGQNLLDLVLAIGSTVIQIPDIHNS
DVYPWLTAFQLTRFYRVILEIPRMKPLLLAVFGNMYGLANMSLFLIILNFVAALVGVQLL
RGDIARGQFIDYGQIYNSFLAAYQLFSSENWTNVLYGVGPPEIPLRQAPVVILYLTGWFS
LANFIVLQMFIAVINENFEIAEESKRSQQASHYWASHQPHETQIPWLRRLNPYMWLKAQP
KAIAVEQLPSSLVLPMQKTLVEDFGLPKGGALNSVRKANPPRLGSARSYIRRLQQLFSGA
SDVDQMPMAPIRKRDSSIPQDPIDEETERYLEVIAALNSDTAAAEDVSDVLYERRAQQAD
FIRDHPTYDKTFWIFSQKNLLRRLCQKVVAPAGGERIFGSRHSPIAHTLFQLVLLLAVVG
GIVVESIATPIYRRNYYLEHGLIRGTWFDNAEAIFGLVLFLEFIIKIIADGLVFTPNAYI
RSIWNILDFLIMAGVVVNLTTGLIFIGGISRLTRSLKALRALRLITLIDIMRSTFESLII
SGVTRILDACLLAILYMIPYAVWGLNIFNGLMKECNDTSVNDVGQCVDEYSNTIYGNSFG
FLVPRVWADPHPSTTFSFDSFRTSLLILFEIVSLEGWIDVTTVAVSLLGPGQQPQMNASQ
FNSIFFLIYNLMGAVIILTLFVSIIIGNFTSKTGSALLTQPQREWIDLQKLIKRQRPSKR
PPRPDWPIRAWCYDRAVHKHGWWHRMMTIIFTLHVIALM
Download sequence
Identical sequences jgi|Pospl1|113887|estExt_Genewise1Plus.C_210090 104341.JGI113887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]