SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI114260 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI114260
Domain Number 1 Region: 681-802
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.31e-19
Family cAMP-binding domain 0.0069
Further Details:      
 
Domain Number 2 Region: 487-601
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000294
Family Anti-sigma factor antagonist SpoIIaa 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI114260
Sequence length 819
Comment (Postia placenta MAD 698)
Sequence
MKGALSLLPRLKLPTPSLRVVKVVSADAVQSLPAVLLGTLLNILDGISYGMIIFPASGVF
SNLGGIGVSMFFLSAIISQLVYSAGGSGFAGANGSMMIEVVPFFHILANSIAADIGEDRP
HEVLATTIVAFALSSVLTGLTFFLLGALRLGALIGFFPRHILVGCIGGVGVFLVITGFTV
STRMPDDDFDLTLSTFKFIFLNAHNLGLWVPSFGLAALLRVVTHKYDHQLIFPMYFLTIP
IIFYIVVAAAHLDLGTLRREGWLFDMGTSREPWYQFYKLFDFKATRWDALWATLPTQFAL
LFFNILHPPLNVPALAVSLNHDVDTDKELVSHGYSNLLAGALGTVPNYLVYVNTVLFYRV
GGTTRVSGFLLAGATAVLLFIGTGPIAFIPVMVVGALIFVLGFDLVKEALWDTRHRVSRM
EYVTIASIMICMTVWDFVIGVLFGIVVSCIFFVVQSSQRRSIRSLHSGETVMSTVRRPGA
HRAYIREVSKQTTILRLQGFLFFGTITYVEETIRTLVEVPAWQRNPMRFLLLDLSLVAGV
DMSAAEAFVRIQRLLAAKRVLLVFCGFSMESTIGKSLHNVGLLDMEGVELFSTFNDALEW
TENIYLRAWFDSQKTEPRSVGMSIMLSGRQDLTPFQESVSGTPRKSLIVDAGWRTIARDH
SPPDADVGDTEEPYITLVKAFSSYGPVDRQQFSALVPYLERVSLPAGAILWLQGDDPDGL
YIVESGVLKATYRFNEHTPPTEESMVPGTLAGELSALSGLSRNATCVVERPAVLWKLSVD
KLRRLESERPQLAREFTQLVLKAAKLDYDILLSALATRQ
Download sequence
Identical sequences jgi|Pospl1|114260|estExt_Genewise1Plus.C_1770023 104341.JGI114260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]