SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI119272 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI119272
Domain Number 1 Region: 528-558,595-656
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000844
Family Anti-sigma factor antagonist SpoIIaa 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI119272
Sequence length 758
Comment (Postia placenta MAD 698)
Sequence
MLSKIKSAAKRIVGAPEEPVPVVSVGHWVRNLSRDPKQDAIDYVTGMFPIFTWIHRYNFG
WLYGDLVAGLTVGIVAVPQSMSYAQIATLPAEYGLYSTFVGTLVYSLFATSKDVNIGPVA
VMSLTVSQIIAYINKTHPGEWDGPQIATTVAFICGFIVLGIGILRLGWIVEFIPAPAVSG
YMTGSAISIVSGQVPGLMGMSGFDTRAATYKVIIETLKHLPDTKLDAAFGLTGLVSLYTI
RWTADYFMRKYPRRQRIFFFISVFRNAFVIIILTLASFLFCRHRKSKSGKYPIKVLGNVP
RGFQHLGPPHIDPELVTALASQLPVATIILVLEHIAISRSFGRVNNYKINPNQEFIAIGV
TNTIGTLFGAYPATGSFSRSALSSKSGVRTPAAGIISSMICLVALYGLTPAFYYIPSAGL
SAVIIHAVADLVASPRQVYSYWRVSPVEFVIWFAAVLVTVFSTIEDGIYTAIATSFALML
VRLARPRSYFLGKVKLRANAKSEAETRDVFVPLEPKASLMNHAVKVMPPAPGVIVYRFEE
SFIYPNSWLLNNVIVDYVKANTRRGRDMSTIKLSDRPWNDPGPRPGQDENAENLGKPMLH
AIVFDFSAISQVDTTAIQALIDTRIEVERWTDRPVEFHFATILSPWVRRALVAGGFGTGA
PASSVPTEIAAVVPYRDGQSSPVSVPASGDLESSLVSEEPRAGSEESAPIDLQDTPFFHF
DLACAVRSAESGLERRTASSRSSLYKSEEIRDDKAVME
Download sequence
Identical sequences jgi|Pospl1|119272|estExt_Genewise1.C_220037 104341.JGI119272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]