SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 104341.JGI121370 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI121370
Domain Number 1 Region: 180-268
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.33e-19
Family Canonical RBD 0.00056
Further Details:      
 
Domain Number 2 Region: 43-126
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.69e-18
Family Canonical RBD 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI121370
Sequence length 269
Comment (Postia placenta MAD 698)
Sequence
MADVAAPPAIPDAMQGVIAAPAPMPGTASVAAPAEPAEPEFISETLYIQNLNEKIKIPVL
KASLRGLFKAYGEVLDVVAHSNLRMRGQAFVSFESADVAKKALKEVKGFPLYSKPMQISF
ARTRSDAVVKKLDAARFEEHKAHRIEQKKSTRYTNPIKRKYRARKMAAELDGPGAVPVSK
RPNVQMPDEYLPPNKILFLQNLPDSVSKDQLMALFSQYPNLYEVRLIPTKKDIAFVEYMD
EGSATVAKDALHNYKLDGENKIKITFARK
Download sequence
Identical sequences A0A1X6NEZ1
jgi|Pospl1|121370|estExt_Genewise1.C_980032 104341.JGI121370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]