SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI126256 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI126256
Domain Number 1 Region: 245-280
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000147
Family Retrovirus zinc finger-like domains 0.0041
Further Details:      
 
Domain Number 2 Region: 91-116
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000209
Family CCCH zinc finger 0.0055
Further Details:      
 
Domain Number 3 Region: 121-147
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000085
Family CCCH zinc finger 0.0064
Further Details:      
 
Weak hits

Sequence:  104341.JGI126256
Domain Number - Region: 173-194
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00641
Family CCCH zinc finger 0.0038
Further Details:      
 
Domain Number - Region: 148-170
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0576
Family CCCH zinc finger 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI126256
Sequence length 283
Comment (Postia placenta MAD 698)
Sequence
MASAAANPLTTPSGLRDIIRPQFHQNNFQEELFVKNELGIKLDKDDQICRLSLTAAGCPL
GLLHCPLRHTTPSTQNFQPPKQLPTHPRERERLATVCKHWLRGLCKKGDACEFLHEYNLR
RMPDCWWYAKYGYCSAGDECLYAHPKERRIECPDYNRGFCKLGPDCPRKHIRRVACQLYL
TGFCPLGPDCPRGHPKTELPPAEAYEPPPQPSGRDLGPPPPGYGRYADFDRPFGGSFPGP
NPPGAGGSGGPPGPRRNLEDVVCFKCGEKGHYANHCRNQIRRR
Download sequence
Identical sequences 104341.JGI111252 104341.JGI126256 jgi|Pospl1|111252|estExt_Genewise1Plus.C_560154 jgi|Pospl1|126256|estExt_fgenesh3_pg.C_260109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]