SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 104341.JGI129046 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI129046
Domain Number 1 Region: 37-142
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000536
Family Pleckstrin-homology domain (PH domain) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI129046
Sequence length 204
Comment (Postia placenta MAD 698)
Sequence
MLSDVCGSWNTDKIVNLLVIKKTLLAPILSRTAVPRSSPICSGYVQHEYKRGKWQKRWME
LREHSLWLSKRDNAKDSVFLCSLNNFDGYYVTRPHKAPKSYVFAVKSTDSLTFFENTADY
VHVFASGEGEGKNWLEKILLARSYVLYQERNVISSTTGGLARAGTRAGQRPAQPLIAVAP
QKAEGPIASASSFEPGSLLAKRQP
Download sequence
Identical sequences 104341.JGI129046 jgi|Pospl1|129046|estExt_fgenesh3_pg.C_2360023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]