SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 104341.JGI129524 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  104341.JGI129524
Domain Number 1 Region: 423-461
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000015
Family Retrovirus zinc finger-like domains 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 104341.JGI129524
Sequence length 472
Comment (Postia placenta MAD 698)
Sequence
MRSLGRARVAYKRVRMMLIHEHRLRFRRELGTGWAASLAVQANVLVQGPGTRHCGVYYIA
FVVAVLTGQNPAEEAFTFTDDDAVALYHYTAVVPYGLDVVTGSSINLLCFDSTTTGRLDT
LFPFSAKHFVLFLTVDNFSPTRSTHHMAQQGLDQGFDGSWGDAGIQQPPQPAPPEAGVIP
IDTADRILFQAVAALGQHQDAFANNQQLQSAALESLARSIDELRQRVSATPAPSTSAGPH
NIKKQKTTLFSMYLKDGSPIQWFNTIEAKRSELLYDWEELQRIFTTRFQDSDLVSMSLRK
LEALKQTGSAATYANLFEEYLTYVDVSDYMQITYFDRNLKPRLKEILVNEKRPATLDEWI
PTVIMADNRLHELERETRELKSKPSGHCHSELAQVTPRVASTPTPAASSSTVVPMEIDAV
RRGPVTAEEKERRRHLGLCFYCGKGKHTIQDCPNMSDKAKKARAKAVPSGKA
Download sequence
Identical sequences 104341.JGI129524 jgi|Pospl1|129524|estExt_fgenesh3_pg.C_280038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]